Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Histone H2A.V(H2AFV)

Recombinant Human Histone H2A.V(H2AFV)

Quick Overview:

Product Code: CSB-EP747894HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: H2AFV Uniprot: Q71UI9
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-128aa MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 29.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen H2AFV
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases H2A.F/Z
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images