Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Insulin-like growth factor 1 receptor(IGF1R),partial

Recombinant Human Insulin-like growth factor 1 receptor(IGF1R),partial

Quick Overview:

Product Code: CSB-MP011087HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: IGF1R Uniprot: P08069
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 763-931aa YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 21.9 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen IGF1R
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Insulin-like growth factor I receptor Short name: IGF-I receptor
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images