Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Interferon-induced helicase C domain-containing protein 1(IFIH1),partial

Recombinant Human Interferon-induced helicase C domain-containing protein 1(IFIH1),partial

Quick Overview:

Product Code: CSB-EP880143HUa2
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: IFIH1 Uniprot: Q9BYX4
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 700-1025aa KLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNEQKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGVIEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRE
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 53.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen IFIH1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Clinically amyopathic dermatomyositis autoantigen 140KDA Short name: CADM-140 autoantigen Helicase with 2 CARD domains Short name: Helicard Interferon-induced with helicase C domain protein 1 Melanoma differentiation-associated protein 5 Short name: MDA-5
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images