Serving Australia and NZ
1300 543 373
Loading...

Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN)

Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN)

Quick Overview:

Product Code: CSB-EP866201HU
Supplier: Cusabio

Details
Recombinant proteins Full Length Gene: IL36RN Uniprot: Q9UBH0
Additional Information
Product Name Recombinant Human Interleukin-36 receptor antagonist protein(IL36RN)
Supplier name Cusabio
Concentration 0.1-2.0mg/ml
Construction 1-155aa MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Source Human
Biological Activity Not Tested
Size 100ug
Endotoxin level Not Tested
Molecular Weight 33 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Species Reactivity Human
Applications WB
Storage/Storage buffer Tris-based buffer, 50% glycerol
Form Liquid
Product Type Proteins
Expression E.coli
Purification Affinity purified
Aliases FIL1 deltaIL-1-related protein 3 ;IL-1RP3Interleukin-1 HY1 ;IL-1HY1Interleukin-1 delta ;IL-1 deltaInterleukin-1 family member 5 ;IL-1F5Interleukin-1 receptor antagonist homolog 1 ;IL-1ra homolog 1Interleukin-1-like protein 1 ;IL-1L1
Datasheet URL View Datasheet
Target/Antigen IL36RN
Publications Publication List

Images