Serving Australia and NZ
1300 543 373
Loading...

Recombinant Human Kita-kyushu lung cancer antigen 1(CT83)

Recombinant Human Kita-kyushu lung cancer antigen 1(CT83)

Quick Overview:

Product Code: CSB-EP711093HU
Supplier: Cusabio

Details
Recombinant proteins Full Length Gene: CT83 Uniprot: Q5H943
Additional Information
Product Name Recombinant Human Kita-kyushu lung cancer antigen 1(CT83)
Supplier name Cusabio
Concentration 0.1-2.0mg/ml
Construction 1-113aa MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Source Human
Biological Activity Not Tested
Size 100ug
Endotoxin level Not Tested
Molecular Weight 26.8 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Species Reactivity Human
Applications WB
Storage/Storage buffer Tris-based buffer, 50% glycerol
Form Liquid
Product Type Proteins
Expression E.coli
Purification Affinity purified
Aliases Cancer/testis antigen 83
Datasheet URL View Datasheet
Target/Antigen CT83
Publications Publication List

Images