Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5(LILRA5),partial

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5(LILRA5),partial

Quick Overview:

Product Code: CSB-MP012937HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: LILRA5 Uniprot: A6NI73
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 42-268aa GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 29.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen LILRA5
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases CD85 antigen-like family member F Immunoglobulin-like transcript 11 Short name: ILT-11 Leukocyte immunoglobulin-like receptor 9 Short name: LIR-9 CD_antigen: CD85f
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images