Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Macrophage colony-stimulating factor 1 receptor(CSF1R),partial

Recombinant Human Macrophage colony-stimulating factor 1 receptor(CSF1R),partial

Quick Overview:

Product Code: CSB-MP006044HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: CSF1R Uniprot: P07333
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 20-512aa IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNL
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 82.0 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen CSF1R
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases CSF-1 receptor (EC:2.7.10.1) (CSF-1-R) (CSF-1R) (M-CSF-R) (Proto-oncogene c-Fms) (CD115) (FMS)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images