Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Mast/stem cell growth factor receptor Kit(KIT),partial

Recombinant Human Mast/stem cell growth factor receptor Kit(KIT),partial

Quick Overview:

Product Code: CSB-MP012375HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: KIT Uniprot: P10721
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 26-516aa QPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHHGDFNYER
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 82.7 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen KIT
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Piebald trait protein (PBT) (Proto-oncogene c-Kit) (Tyrosine-protein kinase Kit) (p145 c-kit) (v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog) (CD_antigen: CD117 ) (SCFR )
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images