Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Mediator of DNA damage checkpoint protein 1(MDC1),partial

Recombinant Human Mediator of DNA damage checkpoint protein 1(MDC1),partial

Quick Overview:

Product Code: CSB-EP623929HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: MDC1 Uniprot: Q14676
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1892-2082aa APKVLFTGVVDARGERAVLALGGSLAGSAAEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFGFSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVITCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLS
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 36.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MDC1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Nuclear factor with BRCT domains 1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images