Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Mediator of RNA polymerase II transcription subunit 1(MED1),partial

Recombinant Human Mediator of RNA polymerase II transcription subunit 1(MED1),partial

Quick Overview:

Product Code: CSB-EP621880HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: MED1 Uniprot: Q15648
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 878-1031aa FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 32.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MED1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Activator-recruited cofactor 205KDA component Short name: ARC205 Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Short name: PBP Short name: PPAR-binding protein Thyroid hormone receptor-associated protein complex 220
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images