Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Midkine(MDK)

Recombinant Human Midkine(MDK)

Quick Overview:

Product Code: CSB-RP105744h
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: MDK Uniprot: P21741
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 21-143aa VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 40.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MDK
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Amphiregulin-associated protein ;ARAPMidgestation and kidney proteinNeurite outgrowth-promoting factor 2Neurite outgrowth-promoting protein
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images