Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 B(TIMM10B)

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim10 B(TIMM10B)

Quick Overview:

Product Code: CSB-EP896532HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: TIMM10B Uniprot: Q9Y5J6
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-103aa MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 27.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen TIMM10B
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Fracture callus protein 1FxC1Mitochondrial import inner membrane translocase subunit Tim9 BTIMM10B ;Tim10b
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images