Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14(DNAJC19)

Recombinant Human Mitochondrial import inner membrane translocase subunit TIM14(DNAJC19)

Quick Overview:

Product Code: CSB-EP853400HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: DNAJC19 Uniprot: Q96DA6
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-116aa ASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 39.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen DNAJC19
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases DnaJ homolog subfamily C member 19
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images