Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Mitochondrial intermembrane space import and assembly protein 40(CHCHD4)

Recombinant Human Mitochondrial intermembrane space import and assembly protein 40(CHCHD4)

Quick Overview:

Product Code: CSB-EP850802HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: CHCHD4 Uniprot: Q8N4Q1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-142aa MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 32 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen CHCHD4
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Coiled-coil-helix-coiled-coil-helix domain-containing protein 4
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images