Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human MORC family CW-type zinc finger protein 3(MORC3),partial

Recombinant Human MORC family CW-type zinc finger protein 3(MORC3),partial

Quick Overview:

Product Code: CSB-EP622753HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: MORC3 Uniprot: Q14149
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-290aa MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPES
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 48.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MORC3
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Nuclear matrix protein 21 Zinc finger CW-type coiled-coil domain protein 3
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images