Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Multiple inositol polyphosphate phosphatase 1(MINPP1)

Recombinant Human Multiple inositol polyphosphate phosphatase 1(MINPP1)

Quick Overview:

Product Code: CSB-EP891977HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: MINPP1 Uniprot: Q9UNW1
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 31-487aa SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDL
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 79.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MINPP1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 2,3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80) ;2,3-BPG phosphataseInositol (1,3,4,5)-tetrakisphosphate 3-phosphatase ;Ins(1,3,4,5)P(4) 3-phosphatase
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images