Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Myosin light polypeptide 6(MYL6),partial

Recombinant Human Myosin light polypeptide 6(MYL6),partial

Quick Overview:

Product Code: CSB-RP051544h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: MYL6 Uniprot: P60660
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 3-151aa DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 43.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MYL6
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 17KDA myosin light chain ;LC17Myosin light chain 3 ;MLC-3Myosin light chain alkali 3 ;Myosin light chain A3Smooth muscle and nonmuscle myosin light chain alkali 6
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images