Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Myosin regulatory light chain 2, atrial isoform(MYL7)

Recombinant Human Myosin regulatory light chain 2, atrial isoform(MYL7)

Quick Overview:

Product Code: CSB-EP889545HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: MYL7 Uniprot: Q01449
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-175aa MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 46.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MYL7
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Myosin regulatory light chain 7
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images