Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform(MYLPF)

Recombinant Human Myosin regulatory light chain 2, skeletal muscle isoform(MYLPF)

Quick Overview:

Product Code: CSB-EP856892HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: MYLPF Uniprot: Q96A32
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-169aa APKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 34.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen MYLPF
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Fast skeletal myosin light chain 2MLC2B
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images