Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Non-POU domain-containing octamer-binding protein(NONO)

Recombinant Human Non-POU domain-containing octamer-binding protein(NONO)

Quick Overview:

Product Code: CSB-EP624018HUb0
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: NONO Uniprot: Q15233
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-471aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQF
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 59.7 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen NONO
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 54 kDa nuclear RNA- and DNA-binding protein (55 kDa nuclear protein) (DNA-binding p52/p100 complex, 52 kDa subunit) (NMT55) (p54(nrb)) () (p54nrb) (NRB54)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images