Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Nuclear factor NF-kappa-B p105 subunit(NFKB1)

Recombinant Human Nuclear factor NF-kappa-B p105 subunit(NFKB1)

Quick Overview:

Product Code: CSB-RP103544h
Supplier: Cusabio

  • Details

    Recombinant proteins Full length Gene: NFKB1 Uniprot: P19838
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-968aa MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNA
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 132.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen NFKB1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases DNA-binding factor KBF1EBP-1Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images