Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human O-acetyl-ADP-ribose deacetylase 1(OARD1)

Recombinant Human O-acetyl-ADP-ribose deacetylase 1(OARD1)

Quick Overview:

Product Code: CSB-EP896727HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: OARD1 Uniprot: Q9Y530
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-152aa ASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 24.3 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen OARD1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases O-acetyl-ADP-ribose deacetylase 1 (EC:3.5.1.-) (Terminal ADP-ribose protein glycohydrolase 1) ([Protein ADP-ribosylglutamate] hydrolase OARD1) (C6orf130) (TARG1)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images