Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Probable ATP-dependent RNA helicase DDX53(DDX53)

Recombinant Human Probable ATP-dependent RNA helicase DDX53(DDX53)

Quick Overview:

Product Code: CSB-EP773024HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: DDX53 Uniprot: Q86TM3
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-631aa MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPPLCFKIKNNMVGVVIGYSGSKIKDLQHSTNTKIQIINGESEAKVRIFGNREMKAKAKAAIETLIRKQESYNSESSVDNAASQTPIGRNLGRNDIVGEAEPLSNWDRIRAAVVECEKRKWADLPPVKKNFYIESKATSCMSEMQVINWRKENFNITCDDLKSGEKRLIPKPTCRFKDAFQQYPDLLKSIIRVGIVKPTP
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 76.2 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen DDX53
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Cancer-associated gene protein Cancer/testis antigen 26 Short name: CT26 DEAD box protein 53 DEAD box protein CAGE CAGE
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images