Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Receptor tyrosine-protein kinase erbB-2(ERBB2),partial

Recombinant Human Receptor tyrosine-protein kinase erbB-2(ERBB2),partial

Quick Overview:

Product Code: CSB-RP097594h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: ERBB2 Uniprot: P04626
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 153-598aa VLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQL
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 53.1 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ERBB2
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Metastatic lymph node gene 19 protein ;MLN 19Proto-oncogene NeuProto-oncogene c-ErbB-2Tyrosine kinase-type cell surface receptor HER2p185erbB2;; CD340
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images