Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Rho guanine nucleotide exchange factor 18(ARHGEF18) ,partial

Recombinant Human Rho guanine nucleotide exchange factor 18(ARHGEF18) ,partial

Quick Overview:

Product Code: CSB-RP052754h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: ARHGEF18 Uniprot: Q6ZSZ5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 159-551aa MTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESIFVEDPYTASLRSEIESDGHEFEAESWSLAVDAAYAKKQKREVVKRQDVLYELMQTEVHHVRTLKIMLKVYSRALQEELQFSSKAIGRLFPCADDLLETHSHFLARLKERRQESLEEGSDRNYVIQKIGDLLVQQFSGENGERMKEKYGVFCSGHNEAVSHYKLLLQQNKKFQNLIKKIGNFSIVRRLG
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 71.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen ARHGEF18
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 114KDA Rho-specific guanine nucleotide exchange factor ;p114-Rho-GEF ;p114RhoGEFSeptin-associated RhoGEF ;SA-RhoGEF
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images