Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Sal-like protein 2 (SALL2)

Recombinant Human Sal-like protein 2 (SALL2)

Quick Overview:

Product Code: CSB-MP896719HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: SALL2 Uniprot: Q9Y467
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 1-198aa QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 25.3 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen SALL2
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Zinc finger protein 795 Zinc finger protein SALL2 Zinc finger protein Spalt-2 Short name: Sal-2 Short name: hSal2
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images