Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Secretory phospholipase A2 receptor(PLA2R1) ,partial

Recombinant Human Secretory phospholipase A2 receptor(PLA2R1) ,partial

Quick Overview:

Product Code: CSB-MP623780HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: PLA2R1 Uniprot: Q13018
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 395-530aa EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 19.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen PLA2R1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 180KDA secretory phospholipase A2 receptor C-type lectin domain family 13 member C M-type receptor
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images