Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Serine/arginine-rich splicing factor 9(SRSF9)

Recombinant Human Serine/arginine-rich splicing factor 9(SRSF9)

Quick Overview:

Product Code: CSB-RP002144h
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: SRSF9 Uniprot: Q13242
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-221aa MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 52.5 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen SRSF9
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Pre-mRNA-splicing factor SRp30CSplicing factor, arginine/serine-rich 9
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images