Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Serine-threonine kinase receptor-associated protein(STRAP)

Recombinant Human Serine-threonine kinase receptor-associated protein(STRAP)

Quick Overview:

Product Code: CSB-EP896713HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: STRAP Uniprot: Q9Y3F4
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-350aa MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKL
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 65.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen STRAP
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases MAP activator with WD repeats UNR-interacting protein WD-40 repeat protein PT-WD
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images