Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15),partial

Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15),partial

Quick Overview:

Product Code: CSB-MP761623HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: SIGLEC15 Uniprot: Q6ZMC9
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 20-263aa FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 30.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen SIGLEC15
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases CD33 antigen-like 3
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images