Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human SOSS complex subunit B2(OBFC2A)

Recombinant Human SOSS complex subunit B2(OBFC2A)

Quick Overview:

Product Code: CSB-EP850257HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: NABP1 Uniprot: Q96AH0
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-204aa MNRVNDPLIFIRDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSEVPNFSEPNPDYRGQQNKGAQSEQKNNSMNSNMGTGTFGPVGNGVHTGPESREHQFSHAGRSNGRGLINPQLQGTASNQTVMTTISNGRDPRRAFKR
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 38.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen NABP1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Nucleic acid-binding protein 1Oligonucleotide/oligosaccharide-binding fold-containing protein 2ASensor of single-strand DNA complex subunit B2Sensor of ssDNA subunit B2 ;SOSS-B2Single-stranded DNA-binding protein 2 ;hSSB2
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images