Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Splicing factor U2AF 26KDA subunit(U2AF1L4)

Recombinant Human Splicing factor U2AF 26KDA subunit(U2AF1L4)

Quick Overview:

Product Code: CSB-EP837850HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Isoform 2 Gene: U2AF1L4 Uniprot: Q8WU68
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-202aa MAEYLASIFGTEKDKVNCSFYFKIGVCRHGDRCSRLHNKPTFSQEVFTELQEKYGEIEEMNVCDNLGDHLVGNVYVKFRREEDGERAVAELSNRWFNGQAVHGNVPEVASATSCICGPFPRTSRGSSMGGDPGAGHPRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKPPSLSCPILPRLPGSIM
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 49 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen U2AF1L4
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases U2 auxiliary factor 26 U2 small nuclear RNA auxiliary factor 1-like protein 4
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images