Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1(SMARCB1),partial

Recombinant Human SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1(SMARCB1),partial

Quick Overview:

Product Code: CSB-EP623654HUa0
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: SMARCB1 Uniprot: Q12824
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-376aa MMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESY
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 49.0 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen SMARCB1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases BRG1-associated factor 47 (BAF47) (Integrase interactor 1 protein) (SNF5 homolog) (hSNF5) (BAF47) (INI1) (SNF5L1)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images