Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

Quick Overview:

Product Code: CSB-MP004966HU
Supplier: Cusabio

  • Details

    Recombinant proteins Extracellular Domain Gene: CD8A Uniprot: P01732
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 22-182aa SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 21.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen CD8A
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images