Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Terminal nucleotidyltransferase 4A(TENT4B)

Recombinant Human Terminal nucleotidyltransferase 4A(TENT4B)

Quick Overview:

Product Code: CSB-EP843329HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: TENT4B Uniprot: Q8NDF8
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-572aa MYRSGERLLGSHALPAEQRDFLPLETTNNNNNHHQPGAWARRAGSSASSPPSASSSPHPSAAVPAADPADSASGSSNKRKRDNKASGGRAAGGGRADGGGVVYSGTPWKRRNYNQGVVGLHEEISDFYEYMSPRPEEEKMRMEVVNRIESVIKELWPSADVQIFGSFKTGLYLPTSDIDLVVFGKWENLPLWTLEEALRKHKVADEDSVKVLDKATVPIIKLTDSFTEVKVDISFNVQNGVRAADLI
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 67.3 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen TENT4B
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases PAP-associated domain-containing protein 5 (Terminal nucleotidyltransferase 4B) (Terminal uridylyltransferase 3) (TUTase 3) (Topoisomerase-related function protein 4-2) (TRF4-2) (GLD4) (PAPD5) (TRF4-2)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images