Serving Australia and NZ
1300 543 373
Loading...

Recombinant Human Thioredoxin-like protein 4B(TXNL4B)

Recombinant Human Thioredoxin-like protein 4B(TXNL4B)

Quick Overview:

Product Code: CSB-EP868342HU
Supplier: Cusabio

Details
Recombinant proteins Full Length Gene: TXNL4B Uniprot: Q9NX01
Additional Information
Product Name Recombinant Human Thioredoxin-like protein 4B(TXNL4B)
Supplier name Cusabio
Concentration 0.1-2.0mg/ml
Construction 1-149aa MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Source Human
Biological Activity Not Tested
Size 100ug
Endotoxin level Not Tested
Molecular Weight 44 kDa
Purity Greater than 90% as determined by SDS-PAGE.
Species Reactivity Human
Applications WB
Storage/Storage buffer Tris-based buffer, 50% glycerol
Form Liquid
Product Type Proteins
Expression E.coli
Purification Affinity purified
Aliases Dim1-like protein
Datasheet URL View Datasheet
Target/Antigen TXNL4B
Publications Publication List

Images