Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Transcription initiation factor TFIID subunit 12(TAF12)

Recombinant Human Transcription initiation factor TFIID subunit 12(TAF12)

Quick Overview:

Product Code: CSB-EP624102HU
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: TAF12 Uniprot: Q16514
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-161aa MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTKK
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 33.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen TAF12
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Transcription initiation factor TFIID 20/15KDA subunits ;TAFII-20/TAFII-15 ;TAFII20/TAFII15
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images