Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Transcriptional enhancer factor TEF-3(TEAD4),partial

Recombinant Human Transcriptional enhancer factor TEF-3(TEAD4),partial

Quick Overview:

Product Code: CSB-EP618010HUa2
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: TEAD4 Uniprot: Q15561
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 74-434aa MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQ
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 56.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen TEAD4
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases TEA domain family member 4 ;TEAD-4Transcription factor 13-like 1Transcription factor RTEF-1
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images