Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Tripartite motif-containing protein 72(TRIM72),partial

Recombinant Human Tripartite motif-containing protein 72(TRIM72),partial

Quick Overview:

Product Code: CSB-EP744394HU1
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: TRIM72 Uniprot: Q6ZMU5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 2-477aa SAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPTRPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVTSRL
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 79.4 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen TRIM72
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Mitsugumin-53 (Mg53) (MG53)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images