Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Tumor necrosis factor receptor superfamily member 11A(TNFRSF11A),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 11A(TNFRSF11A),partial

Quick Overview:

Product Code: CSB-RP084674h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: TNFRSF11A Uniprot: Q9Y6Q6
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 28-202aa LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 23.2 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen TNFRSF11A
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Osteoclast differentiation factor receptor ;ODFRReceptor activator of NF-KB; CD265
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images