Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein(RELT),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein(RELT),partial

Quick Overview:

Product Code: CSB-RP081794h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: RELT Uniprot: Q969Z4
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 26-153aa STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 17.7 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen RELT
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Receptor expressed in lymphoid tissues
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images