Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial

Quick Overview:

Product Code: CSB-EP839000HU
Supplier: Cusabio

  • Details

    Recombinant proteins Extracellular Domain Gene: TNFRSF25 Uniprot: Q93038
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 25-199aa QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 22.9 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen TNFRSF25
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Apo-3 Apoptosis-inducing receptor AIR Apoptosis-mediating receptor DR3 Apoptosis-mediating receptor TRAMP Death receptor 3 Lymphocyte-associated receptor of death Short name:LARD
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images