Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Tumor necrosis factor receptor superfamily member 3(LTBR),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 3(LTBR),partial

Quick Overview:

Product Code: CSB-RP081294h
Supplier: Cusabio

  • Details

    Recombinant proteins Extracellular Domain Gene: LTBR Uniprot: P36941
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 31-224aa QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 25.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen LTBR
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Lymphotoxin-beta receptorTumor necrosis factor C receptorTumor necrosis factor receptor 2-related protein;Tumor necrosis factor receptor type III ;TNF-RIII ;TNFR-III
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images