Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human V-set domain-containing T-cell activation inhibitor 1(B7H4),partial

Recombinant Human V-set domain-containing T-cell activation inhibitor 1(B7H4),partial

Quick Overview:

Product Code: CSB-EP801822HUe0
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: B7H4 Uniprot: Q7Z7D3
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 26-258aa IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 52.6 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen B7H4
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases B7 homolog 4 ;B7-H4B7h.5Immune costimulatory protein B7-H4Protein B7S1T-cell costimulatory molecule B7x
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images