Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human Vascular endothelial growth factor receptor 1(FLT1),partial

Recombinant Human Vascular endothelial growth factor receptor 1(FLT1),partial

Quick Overview:

Product Code: CSB-MP008732HU
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: FLT1 Uniprot: P17948
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 27-756aa SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEK
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 86.2 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen FLT1
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases Fms-like tyrosine kinase 1 (FLT-1) (Tyrosine-protein kinase FRT) (Tyrosine-protein kinase receptor FLT) (FLT) (Vascular permeability factor receptor) (VEGFR-1) (FLT) (FRT) (VEGFR1)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images