Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Human X-ray repair cross-complementing protein 6(XRCC6),partial

Recombinant Human X-ray repair cross-complementing protein 6(XRCC6),partial

Quick Overview:

Product Code: CSB-RP016174h
Supplier: Cusabio

  • Details

    Recombinant proteins Partial Gene: XRCC6 Uniprot: P12956
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 6-222aa SYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPFDMSIQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILELDQFKGQQGQKRFQDMMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIIS
    Source Human
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 28.8 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen XRCC6
    Species Reactivity Human
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 5'-deoxyribose-5-phosphate lyase Ku70 ;5'-dRP lyase Ku7070KDA subunit of Ku antigen;ATP-dependent DNA helicase 2 subunit 1ATP-dependent DNA helicase II 70KDA subunitCTC box-binding factor 75KDA subunit ;CTC75 ;CTCBFDNA repair protein XR;CC6Lupus Ku autoan
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images