Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Kluyveromyces marxianus DNA-directed RNA polymerases I, II, and III subunit RPABC1(RPB5)

Recombinant Kluyveromyces marxianus DNA-directed RNA polymerases I, II, and III subunit RPABC1(RPB5)

Quick Overview:

Product Code: CSB-EP889203KAN
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: RPB5 Uniprot: Q9P4B9
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 1-215aa MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL
    Source Yeast
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 29.0 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen RPB5
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images