Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51(FCGRT),partial

Recombinant Macaca fascicularis IgG receptor FcRn large subunit p51(FCGRT),partial

Quick Overview:

Product Code: CSB-MP851443MOV
Supplier: Cusabio

  • Details

    Recombinant proteins Extracellular Domain Gene: FCGRT Uniprot: Q8SPV9
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 24-297aa AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGD
    Source Cynomolgus monkey
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 33.4 kDa
    Purity Greater than 90% as determined by SDS-PAGE.
    Target/Antigen FCGRT
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases IgG Fc fragment receptor transporter alpha chainNeonatal Fc receptor
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images