Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Methanothermobacter marburgensis F420-dependent NADP reductase(fno)

Recombinant Methanothermobacter marburgensis F420-dependent NADP reductase(fno)

Quick Overview:

Product Code: CSB-MP520438MSQ
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length Gene: fno Uniprot: D9PVP5
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 20ug
    Concentration 0.1-0.5mg/ml
    Expression Mammalian cell
    Construction 1-224aa MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE
    Source Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 27.4 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen fno
    Species Reactivity Other
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases F420H2:NADP oxidoreductase
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images