Serving Australia and NZ
1300 543 373
Return to Previous Page

Recombinant Mouse 5-aminolevulinate synthase, nonspecific, mitochondrial(Alas1)

Recombinant Mouse 5-aminolevulinate synthase, nonspecific, mitochondrial(Alas1)

Quick Overview:

Product Code: CSB-EP844984MO
Supplier: Cusabio

  • Details

    Recombinant proteins Full Length of Mature Protein Gene: Alas1 Uniprot: Q8VC19
  • Additional Information

    Supplier name Cusabio
    Product Type Proteins
    Size 100ug
    Concentration 0.1-2.0mg/ml
    Expression E.coli
    Construction 57-642aa QVKETPPANEKEKTAKAAVQQAPDESQMAQTPDGTQLPSGHPSPATSQGSGSKCPFLAAQLSQTGSSVFRKASLELQEDVQEMHAVRKEAAQSPVPPSLVNVKTDGEDPSRLLKNFQDIMRKQRPERVSHLLQDNLPKSVSTFQYDHFFEKKIDEKKNDHTYRVFKTVNRRAQIFPMADDYTDSLITKKQVSVWCSNDYLGMSRHPRVCGAVMETVKQHGAGAGGTRNISGTSKFHVELEQALADL
    Source Mouse
    Biological Activity Not Tested
    Endotoxin level Not Tested
    Molecular Weight 72.3 kDa
    Purity Greater than 85% as determined by SDS-PAGE.
    Target/Antigen Alas1
    Species Reactivity Mouse
    Applications WB
    Storage/Storage buffer Tris-based buffer, 50% glycerol
    Form Liquid
    Purification Affinity purified
    Aliases 5-aminolevulinic acid synthase 1 (Delta-ALA synthase 1) (Delta-aminolevulinate synthase 1) (ALAS-H)
    Publications Publication List
    Datasheet URL View Datasheet
    Categories Proteins,Recombinant proteins
  • Images